sermorelin
GH AXIS · GHRH-R AGONIST · 29 AA · T½ ~11-12 MIN
also: Geref · Geref Diagnostic · GRF(1-29)NH2
Sermorelin is the shortest fully active fragment of human GHRH and acts as a GHRH-receptor agonist on pituitary somatotrophs. It held FDA approval as Geref before that approval was withdrawn in 2009 following commercial discontinuation; FDA determined in 2013 that the withdrawal was not for reasons of safety or effectiveness. There is no marketing authorisation for it in the UK.
// our evidence grade — unedited
It is the only compound here besides tesamorelin with a genuine FDA approval history and a published registration dataset showing a hard growth outcome in children, but the product was withdrawn and the adult anti-ageing trials are small and largely negative.
We grade this compound and we sell it. The grade is set against our published criteria before any stocking decision and is not adjusted because it is in the catalogue.
read the full evidence →// specification
| full name | human growth hormone-releasing hormone (1-29) amide |
| cas | 86168-78-7 |
| formula | C149H246N44O42S |
| molar mass | 3357.89 g/mol |
| purity | ≥ 98% HPLC |
| form | lyophilised powder, sealed vial |
| storage | Lyophilised sermorelin acetate is stored desiccated at -20 °C or below for long-term laboratory storage and protected from light. Reconstituted solution is held at 2-8 °C and is not intended for extended storage. |
| solubility | Readily soluble in sterile or bacteriostatic water; laboratory stocks are commonly prepared in water or dilute aqueous buffer. |
| sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
// select size
crypto payment · research use only · not for human consumption
// others in Growth Hormone