igf-1 des
GH AXIS · TRUNCATED IGF-1 VARIANT · 67 AA · IGFBP-EVADING · REAGENT
also: IGF-1 DES · IGF-1 DES(1-3) · des(1-3)IGF-I
des(1-3)IGF-1 is a naturally occurring truncated form of insulin-like growth factor-I, 67 residues instead of 70, produced by post-translational removal of the N-terminal Gly-Pro-Glu tripeptide and isolated from bovine colostrum, human brain and porcine uterus. Losing the glutamate at position 3 sharply reduces its affinity for the IGF-binding proteins, which makes it roughly ten times more potent than intact IGF-I in cultured cells. Its documented use is as a cell-culture and receptor-biology research reagent; there has never been a human trial of any kind.
// our evidence grade — unedited
ClinicalTrials.gov returns zero registered studies and PubMed zero clinical-trial records for des(1-3)IGF-I, and the 1996 review written by the group that isolated and characterised the molecule states that 'clinical opportunities for des(1-3)IGF-I have not yet been evaluated' — a statement that still stands three decades later. It is supplied only as a research reagent whose stated potency assay is proliferation of human breast cancer cells.
We grade this compound and we sell it. The grade is set against our published criteria before any stocking decision and is not adjusted because it is in the catalogue.
read the full evidence →// specification
| full name | des(1-3) insulin-like growth factor-I — human IGF-I lacking the N-terminal tripeptide Gly-Pro-Glu |
| molar mass | 7400 g/mol |
| purity | ≥ 95% (SDS-PAGE / HPLC) |
| form | lyophilised powder, sealed vial |
| storage | Recombinant protein: stored lyophilised at -20 °C to -80 °C, desiccated and protected from light. Reconstituted solution is aliquoted and held at -80 °C, with freeze-thaw cycles avoided because disulfide-linked dimers aggregate readily. Handling information only. |
| solubility | Reconstituted in sterile buffer; carrier protein is commonly added in cell-culture use to reduce adsorption losses. |
| sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
// select size
crypto payment · research use only · not for human consumption
// others in Growth Hormone