gdf-8
TGF-BETA SUPERFAMILY LIGAND · MUSCLE GROWTH INHIBITOR · ASSAY REAGENT
also: GDF-8 · GDF8 · myostatin
GDF-8, better known as myostatin, is a TGF-beta superfamily protein encoded by MSTN and expressed largely in skeletal muscle, where it acts as a negative regulator of muscle growth. It is produced as a 375-residue precursor whose C-terminal 109-residue chain forms the active disulfide-linked homodimer, held latent in circulation by its own cleaved propeptide. Recombinant GDF-8 is sold as a research-use-only laboratory reagent — an immunoassay standard, a ligand for receptor-binding and inhibitor-screening work, and an atrophy stimulus in muscle cell culture — and has never been given to a human in a registered study.
// our evidence grade — unedited
No clinical trial has ever administered myostatin to a human, and the only documented consequence of raising systemic myostatin in an adult mammal is wasting — Zimmers et al. (Science 2002) produced 'profound muscle and fat loss analogous to that seen in human cachexia syndromes' in mature mice. All 153 ClinicalTrials.gov records mentioning myostatin either measure it or block it; the molecule's documented research role is to be inhibited, not given.
We grade this compound and we sell it. The grade is set against our published criteria before any stocking decision and is not adjusted because it is in the catalogue.
read the full evidence →// specification
| full name | Growth/differentiation factor 8 (myostatin) — mature C-terminal disulfide-linked homodimer |
| molar mass | 12400 g/mol |
| purity | ≥ 95% (SDS-PAGE) |
| form | lyophilised powder, sealed vial |
| storage | Recombinant protein: stored lyophilised at -20 °C to -80 °C, desiccated and protected from light. Reconstituted solution is aliquoted and held at -80 °C, with freeze-thaw cycles avoided because disulfide-linked dimers aggregate readily. Handling information only. |
| solubility | Reconstituted in sterile buffer; carrier protein is commonly added in cell-culture use to reduce adsorption losses. |
| sequence | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
// select size
crypto payment · research use only · not for human consumption
// others in Anabolic & Receptor