F tier · safety concern
No clinical trial has ever administered myostatin to a human, and the only documented consequence of raising systemic myostatin in an adult mammal is wasting — Zimmers et al. (Science 2002) produced 'profound muscle and fat loss analogous to that seen in human cachexia syndromes' in mature mice. All 153 ClinicalTrials.gov records mentioning myostatin either measure it or block it; the molecule's documented research role is to be inhibited, not given.
gdf-8
GDF-8, better known as myostatin, is a TGF-beta superfamily protein encoded by MSTN and expressed largely in skeletal muscle, where it acts as a negative regulator of muscle growth. It is produced as a 375-residue precursor whose C-terminal 109-residue chain forms the active disulfide-linked homodimer, held latent in circulation by its own cleaved propeptide. Recombinant GDF-8 is sold as a research-use-only laboratory reagent — an immunoassay standard, a ligand for receptor-binding and inhibitor-screening work, and an atrophy stimulus in muscle cell culture — and has never been given to a human in a registered study.
// we supply this one
available as a research reagent
≥ 95% (SDS-PAGE) · lyophilised powder · batch certificate published. Grade F above is our own and is not adjusted because we stock it.
the explanation
Myostatin is the body's own brake on muscle growth: animals born without it are enormously muscular, and a child with a broken copy of the gene had unusually large muscles. GDF-8 is that brake, sold as a purified protein. Giving it to an animal does the opposite of what people want — it causes muscle and fat to waste away — which is why every drug in this area, from ACE-031 to the antibodies now in obesity trials, is designed to block it rather than supply it. In a laboratory the protein's job is to be the thing an inhibitor is tested against.
regulatory status
Not a medicine anywhere; research-use-only laboratory reagent, and not itself prohibited in sport
No myostatin protein product holds a marketing authorisation from the MHRA, EMA or FDA, and no myostatin protein has ever entered a registered clinical trial; all regulatory and investigational activity in this axis is on the inhibitor side. In the UK it is not a licensed medicinal product, is not a controlled drug, and is not sold or recognised as a food-supplement ingredient — lawful supply is as a laboratory reagent not for human use, and suppliers label it 'for research use only'. Notably, the 2026 WADA Prohibited List does not name myostatin itself: section S4.3, 'Agents preventing activin receptor IIB activation', prohibits decoy activin receptors such as ACE-031, anti-activin receptor IIB antibodies such as bimagrumab, agents reducing or ablating myostatin expression, myostatin-binding proteins such as follistatin and myostatin propeptide, and myostatin-neutralising antibodies. The whole of that section exists to ban the things that remove what a GDF-8 vial contains.
how it works · proposed mechanism
GDF-8 is a brake on skeletal muscle, and the mechanism is one of the best-established in muscle biology — which is exactly why supplying the ligand points the wrong way.
Negative regulator of muscle mass
UniProt records GDF-8's function as acting 'specifically as a negative regulator of skeletal muscle growth'. Signalling runs through activin receptor IIB with type I partners to SMAD2/3, restraining myofibre protein accretion and satellite-cell proliferation. Deleting the gene in mice produced individual muscles two to three times heavier than normal through both increased fibre number and increased fibre size.
Latency is part of the design
The 375-residue precursor is cleaved into a propeptide and a disulfide-linked C-terminal dimer, and the circulating form is a latent complex in which the propeptide keeps the dimer inactive until a tolloid-like metalloproteinase cleaves it. A vial of mature dimer is the activated ligand supplied without the physiological restraint that normally accompanies it.
What administering it actually does
Zimmers and colleagues showed that myostatin circulates in adult mouse blood in a latent, acid-activatable form, and that systemic overexpression in mature mice induced 'profound muscle and fat loss analogous to that seen in human cachexia syndromes'. That is the only documented outcome of raising systemic myostatin in an adult mammal, and it is the outcome the research market is trying to avoid.
Its research role is to be the target
The commercial reagent's bioactivity is certified by induction of haemoglobin expression in K562 leukaemia cells, an activin-family SMAD readout unrelated to muscle. In practice recombinant GDF-8 functions as an immunoassay calibration standard, as the competing ligand in ActRIIB binding assays, as the positive control in inhibitor screens, and as an atrophy stimulus applied to myotubes in culture.
what’s reported
evidence shape
7 sourcesThe composition of the cited literature by study type. This describes the shape of the evidence, not its quality — and it does not by itself set the grade.
⚠ the catch
GDF-8 is the molecule that the rest of this shelf exists to remove, so selling it as a growth product inverts its own pharmacology. The one published experiment that raised systemic myostatin in adult mammals produced a cachexia phenotype: profound muscle and fat loss in mature mice. No human has ever received myostatin in a registered trial, and of the 153 ClinicalTrials.gov records mentioning it, the interventional ones use anti-myostatin antibodies such as apitegromab and trevogrumab, decoy receptors such as ACE-031, or ligand traps — including a current obesity programme combining trevogrumab with semaglutide. Its documented purpose as a reagent is to be inhibited, quantified or competed against in an assay, and even that role is certified by a haemoglobin-induction test in a leukaemia cell line rather than by any muscle endpoint. Listing GDF-8 next to ACE-031 or follistatin-344 is internally contradictory: the same catalogue is selling the brake and the tools for cutting it.
key published findings
- Protein identity (UniProt O14793, GDF8_HUMAN): MSTN encodes a 375-residue, 42,750 Da precursor; propeptide residues 24-266, mature GDF-8 chain residues 267-375; the protein 'undergoes proteolytic cleavage to generate an N-terminal propeptide and a disulfide linked C-terminal dimer', circulates as a latent complex with its propeptide, requires cleavage of the prodomain by a tolloid-like metalloproteinase for activation, and 'acts specifically as a negative regulator of skeletal muscle growth'.
- Reagent specification (R&D Systems 788-G8, recombinant human/mouse/rat GDF-8/myostatin): NS0-derived mature chain, predicted monomer mass 12.4 kDa running near 12 kDa reduced and 24 kDa non-reduced as a disulfide-linked homodimer, purity greater than 90%, labelled 'for research use only', with bioactivity determined by 'ability to induce hemoglobin expression in K562 human chronic myelogenous leukemia cells' — an activin-family readout with no muscle endpoint.
- The effect of raising myostatin (Zimmers et al., Science 2002;296:1486-1488): myostatin circulates in adult mouse blood in a latent form activatable by acid treatment, and systemic overexpression in mature mice induced 'profound muscle and fat loss analogous to that seen in human cachexia syndromes', with the authors framing myostatin as a target for intervention in unwanted muscle wasting.
- Loss of function is the anabolic direction (McPherron, Lawler, Lee; Nature 1997;387:83-90): mice with GDF-8 deleted were significantly larger with 'a large and widespread increase in skeletal muscle mass', individual muscles weighing two to three times more than normal from increased cell number and size, establishing GDF-8 as 'a negative regulator of skeletal muscle growth'. Human genetics point the same way — Schuelke et al. (N Engl J Med 2004;350:2682-2688) reported a myostatin mutation associated with gross muscle hypertrophy in a child — so the muscle-building evidence attaches to losing myostatin function, never to supplying the ligand.
- Registry direction of travel: exact-phrase interventional searches on ClinicalTrials.gov return no study administering GDF-8. The two records naming GDF-8 in the intervention field are a study measuring GDF-8 levels in ICSI cycles and NCT06299098, a weight-management programme combining trevogrumab — an anti-myostatin antibody — with semaglutide and garetosmab, i.e. myostatin blockade rather than supply.
- Anti-doping framing (2026 Prohibited List): section S4.3 prohibits 'Activin A-neutralizing antibodies; Activin receptor IIB competitors such as: Decoy activin receptors (e.g. ACE-031); Anti-activin receptor IIB antibodies (e.g. bimagrumab); Myostatin inhibitors such as: Agents reducing or ablating myostatin expression; Myostatin-binding proteins (e.g. follistatin, myostatin propeptide); Myostatin- or precursor- neutralizing antibodies'. Myostatin itself appears nowhere on the list.
limitations of the evidence
- There is no human administration of myostatin of any kind, so no human pharmacokinetics, safety or exposure-response data exist — and no therapeutic hypothesis has been advanced that would justify generating them.
- Even the harm direction rests on a single 2002 mouse study using systemic overexpression rather than injection of a purified manufactured preparation, so the effect of a commercial GDF-8 product on an adult mammal has not been directly measured.
- Recombinant preparations are not interchangeable: expression system, presence or absence of the propeptide and activation state all differ between products, and a latent propeptide complex and an activated mature dimer have different biology that vendor certificates rarely resolve.
- The human genetic evidence is a single case report plus animal genetics, informative about the pathway and silent about administering the ligand.
- Lot activity is benchmarked in a leukaemia cell line rather than against any muscle endpoint, so a certificate of analysis does not establish muscle-relevant potency.
- The compound has no coherent stated purpose in the research-reagent market it is sold into: catalogues that list it alongside myostatin inhibitors provide no account of what a buyer would do with an agonist of muscle-growth restraint.
documented safety signals
- The documented pharmacology of raising systemic myostatin in an adult mammal is muscle and fat wasting — a cachexia phenotype in mature mice. This is a wasting stimulus, not an anabolic one.
- Myostatin activity is a therapeutic target in disease-associated muscle wasting, where the goal is to reduce it; supplying exogenous ligand moves in the direction that clinical development treats as the disease.
- Material is supplied as a research reagent with no sterility, endotoxin or human-use qualification, and mammalian-cell-derived preparations carry non-human glycosylation whose immunogenicity in humans has never been assessed.
- No human safety data exist because no human exposure has been studied; the absence of reported harm reflects the absence of any trial, not a favourable safety record.
identity
| full name | Growth/differentiation factor 8 (myostatin) — mature C-terminal disulfide-linked homodimer |
| category | Anabolic & Receptor |
| modality | protein hormone |
| molar mass | 12400 g/mol |
| half-life | Not established for any administered preparation. Endogenous myostatin circulates as a latent complex with its own propeptide and requires further proteolytic cleavage by a tolloid-like metalloproteinase to become active, so circulating immunoreactive protein and biologically active ligand are not the same quantity and no meaningful half-life has been published for an exogenous product. |
| sequence | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
laboratory handling
| storage | Recombinant protein: stored lyophilised at -20 °C to -80 °C, desiccated and protected from light. Reconstituted solution is aliquoted and held at -80 °C, with freeze-thaw cycles avoided because disulfide-linked dimers aggregate readily. Handling information only. |
| solubility | Reconstituted in sterile buffer; carrier protein is commonly added in cell-culture use to reduce adsorption losses. |
| co-studied with | Selling GDF-8 beside myostatin inhibitors is self-contradictory: ACE-031 (graded F in this index) and follistatin-344 (F) exist specifically to neutralise the protein a GDF-8 vial contains, and combining them would simply titrate one against the other. The only coherent laboratory pairing is exactly that — GDF-8 as the ligand an inhibitor is tested against, or as an immunoassay standard. |
Handling information describes laboratory practice for a research reagent. It is not a preparation guide for use in humans.
the receipts
7 citedUniProt Consortium · 2025 · official
R&D Systems / Bio-Techne · 2025 · official
ClinicalTrials.gov, US National Library of Medicine · 2024 · official
World Anti-Doping Agency (official list text as published for 2026) · 2026 · official
Science 296:1486-1488 (Zimmers TA, Davies MV, Koniaris LG, et al.) · 2002 · preclinical
Nature 387:83-90 (McPherron AC, Lawler AM, Lee SJ) · 1997 · preclinical
New England Journal of Medicine 350:2682-2688 (Schuelke M, Wagner KR, Stolz LE, et al.) · 2004 · observational
others in Anabolic & Receptor