← catalogue

foxo4-dri

SENOLYTIC D-RETRO-INVERSO PEPTIDE

also: FOXO4-DRI · FOXO4 DRI · ES2

FOXO4-DRI is an all-D retro-inverso peptide designed to disrupt the FOXO4-p53 interaction that keeps senescent cells alive, triggering apoptosis selectively in those cells. It has produced striking results in aged and progeroid mice but has never been tested in a registered human trial, so all claims about human effects are extrapolation.

≥ 99% HPLClyophilised powderbatch COA
D

// our evidence grade — unedited

The entire clinical case rests on one 2017 Cell paper plus a scattering of rodent and in vitro follow-ups, with zero registered human trials on ClinicalTrials.gov.

We grade this compound and we sell it. The grade is set against our published criteria before any stocking decision and is not adjusted because it is in the catalogue.

read the full evidence →

// specification

full nameFOXO4 D-Retro-Inverso peptide
formulaC228H388N86O64
molar mass5358.1 g/mol
purity≥ 99% HPLC
formlyophilised powder, sealed vial
storageReference material is handled as a lyophilised powder stored frozen (typically -20C or colder), protected from light and moisture; highly basic arginine-rich peptides are hygroscopic and degrade in solution, so reconstituted stability is short.
solubilityThe arginine-rich TAT segment makes the peptide readily water-soluble; supplier data generally report solubility in water or aqueous buffer, though no independently verified solubility figure was located.
sequenceltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (46 residues, all-D retro-inverso; FOXO4 forkhead-domain fragment fused to an HIV-TAT cell-penetrating sequence)

// select size

quantity
total

crypto payment · research use only · not for human consumption

foxo4-dri is supplied as a laboratory research reagent. It is not a medicine and is not for human or animal consumption. We publish no dosing, no administration route and no protocol, and will not provide them on request.

// others in Longevity