foxo4-dri
SENOLYTIC D-RETRO-INVERSO PEPTIDE
also: FOXO4-DRI · FOXO4 DRI · ES2
FOXO4-DRI is an all-D retro-inverso peptide designed to disrupt the FOXO4-p53 interaction that keeps senescent cells alive, triggering apoptosis selectively in those cells. It has produced striking results in aged and progeroid mice but has never been tested in a registered human trial, so all claims about human effects are extrapolation.
// our evidence grade — unedited
The entire clinical case rests on one 2017 Cell paper plus a scattering of rodent and in vitro follow-ups, with zero registered human trials on ClinicalTrials.gov.
We grade this compound and we sell it. The grade is set against our published criteria before any stocking decision and is not adjusted because it is in the catalogue.
read the full evidence →// specification
| full name | FOXO4 D-Retro-Inverso peptide |
| formula | C228H388N86O64 |
| molar mass | 5358.1 g/mol |
| purity | ≥ 99% HPLC |
| form | lyophilised powder, sealed vial |
| storage | Reference material is handled as a lyophilised powder stored frozen (typically -20C or colder), protected from light and moisture; highly basic arginine-rich peptides are hygroscopic and degrade in solution, so reconstituted stability is short. |
| solubility | The arginine-rich TAT segment makes the peptide readily water-soluble; supplier data generally report solubility in water or aqueous buffer, though no independently verified solubility figure was located. |
| sequence | ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (46 residues, all-D retro-inverso; FOXO4 forkhead-domain fragment fused to an HIV-TAT cell-penetrating sequence) |
// select size
crypto payment · research use only · not for human consumption
// others in Longevity