ll-37
HOST DEFENCE · CATHELICIDIN · 37 AA
also: cathelicidin LL-37 · hCAP-18/LL-37 · CAP-18 fragment
LL-37 is the only human cathelicidin, a 37-residue cationic amphipathic host-defence peptide released from the hCAP18 precursor, with broad antimicrobial and immunomodulatory activity. A small randomised placebo-controlled trial in hard-to-heal venous leg ulcers showed a significant benefit at the lowest concentration tested, but no larger confirmatory trial has followed.
// our evidence grade — unedited
It is a genuine endogenous human peptide with an enormous mechanistic literature and one small but properly randomised, placebo-controlled human ulcer trial, yet development stopped there and FDA has noted nonclinical findings suggesting detrimental effects.
We grade this compound and we sell it. The grade is set against our published criteria before any stocking decision and is not adjusted because it is in the catalogue.
read the full evidence →// specification
| full name | Human cathelicidin antimicrobial peptide LL-37 (CAMP gene product, hCAP18 C-terminal fragment) |
| cas | 154947-66-7 |
| formula | C205H340N60O53 |
| molar mass | 4493.26 g/mol |
| purity | ≥ 99% HPLC |
| form | lyophilised powder, sealed vial |
| storage | Lyophilised powder is typically stored at -20 °C, with supplier stability data supporting up to three years; stock solutions are held at -80 °C for up to a year or at -20 °C for about a month, avoiding repeated freeze-thaw. |
| solubility | Highly water-soluble in laboratory settings, with supplier data reporting 50-100 mg/mL in water; commonly prepared in sterile water or low-ionic-strength buffer since activity is salt-sensitive. |
| sequence | [LL-37, 37 aa] |
// select size
crypto payment · research use only · not for human consumption
// others in Healing & Repair